DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and gcy-7

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001360539.1 Gene:gcy-7 / 179222 WormBaseID:WBGene00001534 Length:1117 Species:Caenorhabditis elegans


Alignment Length:247 Identity:128/247 - (51%)
Similarity:171/247 - (69%) Gaps:5/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 IQLYALNL----SQKAKELKREKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVG 502
            ::.||.:|    |::.|||..||:|||.||::|||.:||.:||..|.|..|.:|.|||:|||:|.
 Worm   840 LESYASSLEEEVSERTKELVEEKKKSDVLLYRMLPKTVADKLKLGQTVEPETFEQVTIFFSDVVQ 904

  Fly   503 FTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMA 567
            ||.:|:.||||:||..||.:|.:||..||.:||||||||||.|:..||||.:|||:|:.:||.|:
 Worm   905 FTTLASKCTPLQVVNLLNDLYTIFDGIIEKHDVYKVETIGDGYLCVSGLPHRNGNEHVRQIALMS 969

  Fly   568 LDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKI 632
            |..|.:...||:|....|.:.:|.|::.|.||||:||..|||:|||||.|||||||||.|:..||
 Worm   970 LAFLSSLQFFRVPHLPSERINLRIGMNCGSVVAGVVGLTMPRFCLFGDAVNTASRMESNGKPGKI 1034

  Fly   633 HITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCK-DGPVRAREEIS 683
            |::.|.:..|..||||.||.||.:.:||||:|.|:|||.: .|.|.....:|
 Worm  1035 HVSAEANRMLHLVGGFDTESRGEVIIKGKGVMETFWLTGQGTGAVSGARHVS 1086

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 19/40 (48%)
CYCc 459..647 CDD:214485 102/187 (55%)
Guanylate_cyc 485..669 CDD:278633 100/183 (55%)
gcy-7NP_001360539.1 PBP1_NPR_GC-like 36..438 CDD:380575
PKc_like 550..822 CDD:389743
CYCc 860..1049 CDD:214485 102/188 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.