DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and acy-1

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_497970.1 Gene:acy-1 / 175622 WormBaseID:WBGene00000068 Length:1253 Species:Caenorhabditis elegans


Alignment Length:301 Identity:82/301 - (27%)
Similarity:140/301 - (46%) Gaps:59/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 LSQKAKELKREKRKSDS------------LLFQMLPPSVAMQLKQTQQVPAELYEAVTIYFSDIV 501
            |.:.|.||:|....:||            .|.:|:|     :.::.:.....|...|:|.|:||.
 Worm   267 LLKDASELRRPSASNDSNCRTSNATQVDQPLAKMVP-----EYRKFRPFTMNLMTNVSILFADIA 326

  Fly   502 GFTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKHISEIATM 566
            |||:::::.:..|:|..||.::..||.......:.|:.|:||.|...:|.| :..:.|......|
 Worm   327 GFTKMSSNKSADELVNLLNDLFGRFDTLCRLRGLEKISTLGDCYYCVAGCP-EPCDDHACRTVEM 390

  Fly   567 ALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQK 631
            .||::.|...|.|.| |.| |.:|.|:|||.|:.|:||||..::.:|.:.|..|:.|||:|.|.:
 Worm   391 GLDMIVAIRQFDIDR-GQE-VNMRVGIHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSGVAGR 453

  Fly   632 IHITE----------EMHDSLQQVGGFR-----TEHRGLIDVKGKGLMSTYWL--TCKDGPVRAR 679
            :|::|          |:.:.....|..|     ||.|    ||.:. |.|:::  ...||   ..
 Worm   454 VHVSEATAKLLKGLYEIEEGPDYDGPLRMQVQGTERR----VKPES-MKTFFIKGRINDG---VE 510

  Fly   680 EEI--------------SWRADIQPVFLDHLKLHPPTDYKL 706
            ||:              |.::.::..:.:.||::....|.:
 Worm   511 EEVMQVQEVESLHSQKSSKKSTLKQKWAEKLKMNHTNSYPM 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 10/41 (24%)
CYCc 459..647 CDD:214485 60/209 (29%)
Guanylate_cyc 485..669 CDD:278633 64/198 (32%)
acy-1NP_497970.1 MreD 127..>223 CDD:294686
CYCc 297..469 CDD:214485 57/179 (32%)
Guanylate_cyc 317..503 CDD:278633 63/193 (33%)
SDF <773..982 CDD:294387
CYCc 1016..1215 CDD:214485
Guanylate_cyc 1041..1235 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.