DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Gucy2f

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_446283.1 Gene:Gucy2f / 116556 RGDID:620439 Length:1108 Species:Rattus norvegicus


Alignment Length:246 Identity:125/246 - (50%)
Similarity:170/246 - (69%) Gaps:5/246 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 LVKNAAATIQLYALNLS----QKAKELKREKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVT 494
            ::.:....::.|:.||.    ::.:||:.||:|::.||.||||||||..||:...|..|.::.||
  Rat   820 IIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVT 884

  Fly   495 IYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKH 559
            :|||||||||.|:|...|:|||..||.:|.:||..|..:||||||||||:||||||||.:||::|
  Rat   885 LYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRH 949

  Fly   560 ISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRME 624
            .:|||.|:||:|.:...|::....:..|:||.|:||||||||:||..||||||||||||||||||
  Rat   950 AAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHTGPVVAGVVGLTMPRYCLFGDTVNTASRME 1014

  Fly   625 STGEAQKIHITEEMHDSLQQVG-GFRTEHRGLIDVKGKGLMSTYWLTCKDG 674
            |||...:||::......|:.:. |:..|.||..::||||...|:||..|.|
  Rat  1015 STGLPYRIHVSLSTVTILRTLSEGYEVELRGRTELKGKGTEETFWLVGKKG 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 18/43 (42%)
CYCc 459..647 CDD:214485 107/188 (57%)
Guanylate_cyc 485..669 CDD:278633 101/184 (55%)
Gucy2fNP_446283.1 PBP1_sensory_GC_DEF_like 54..435 CDD:107366
ANF_receptor 75..412 CDD:279440
PKc_like 545..815 CDD:304357
TyrKc 565..809 CDD:197581
HNOBA <824..869 CDD:285003 18/44 (41%)
CYCc 848..1040 CDD:214485 108/191 (57%)
Guanylate_cyc 875..1062 CDD:278633 103/186 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.