DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Adcy7

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_006530643.1 Gene:Adcy7 / 11513 MGIID:102891 Length:1146 Species:Mus musculus


Alignment Length:241 Identity:84/241 - (34%)
Similarity:131/241 - (54%) Gaps:29/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 KELKREKRKSDS-------LLFQMLPPSVAMQL---KQTQQVPAELYEAVTIYFSDI----VGFT 504
            |:.|:|..:.::       ||..:||..||...   |..:....:.|:.|.:.|:.:    |.:|
Mouse   848 KKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYDCVCVMFASVPDFKVFYT 912

  Fly   505 EIAADCTPLEVVTFLNSIYRVFDERI---ECYDVYKVETIGDSYMVASGLPVKNGNK-------- 558
            |...:...||.:..||.|...|||.:   :...|.|::|||.:||.|:||...:|::        
Mouse   913 ECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSAPSGHENQDLERKH 977

  Fly   559 -HISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASR 622
             ||..:...::.|:  |.:..|.|......::|.|::.|||:||::|.:.|:|.::|:|||.|||
Mouse   978 VHIGVLVEFSMALM--SKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASR 1040

  Fly   623 MESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYW 668
            ||||||..||.:|||....||.: |:..|.||||:|||||.:.||:
Mouse  1041 MESTGELGKIQVTEETCTILQGL-GYSCECRGLINVKGKGELRTYF 1085

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 9/31 (29%)
CYCc 459..647 CDD:214485 69/213 (32%)
Guanylate_cyc 485..669 CDD:278633 74/200 (37%)
Adcy7XP_006530643.1 AC_N <75..251 CDD:318454
Guanylate_cyc 272..422 CDD:306677
DUF1053 487..593 CDD:399378
Guanylate_cyc 890..1085 CDD:306677 73/197 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.