DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and ADCY7

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_011521137.1 Gene:ADCY7 / 113 HGNCID:238 Length:1086 Species:Homo sapiens


Alignment Length:252 Identity:87/252 - (34%)
Similarity:135/252 - (53%) Gaps:36/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 KELKREKRKSDS-------LLFQMLPPSVAMQL---KQTQQVPAELYEAVTIYFSDI----VGFT 504
            |:.|:|..:.::       ||..:||..||...   |..:....:.|:.|.:.|:.:    |.:|
Human   829 KKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYT 893

  Fly   505 EIAADCTPLEVVTFLNSIYRVFDERI---ECYDVYKVETIGDSYMVASGLPVKNGNK-------- 558
            |...:...||.:..||.|...|||.:   :...|.|::|||.:||.|:||.|.:|::        
Human   894 ECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQH 958

  Fly   559 -HISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASR 622
             ||..:...::.|:  |.:..|.|......::|.|::.|||:||::|.:.|:|.::|:|||.|||
Human   959 AHIGVMVEFSIALM--SKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASR 1021

  Fly   623 MESTGEAQKI------HITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCKD 673
            ||||||..||      .:|||....||.: |:..|.||||:|||||.:.||:: |.|
Human  1022 MESTGELGKIQVSLPFQVTEETCTILQGL-GYSCECRGLINVKGKGELRTYFV-CTD 1076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 9/31 (29%)
CYCc 459..647 CDD:214485 70/219 (32%)
Guanylate_cyc 485..669 CDD:278633 75/205 (37%)
ADCY7XP_011521137.1 AC_N <73..249 CDD:292831
CYCc 224..429 CDD:214485
Guanylate_cyc 270..432 CDD:278633
DUF1053 485..592 CDD:283888
CYCc 848..1052 CDD:214485 69/206 (33%)
Guanylate_cyc 871..1073 CDD:278633 75/204 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.