DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and ADCY6

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001377760.1 Gene:ADCY6 / 112 HGNCID:237 Length:1168 Species:Homo sapiens


Alignment Length:280 Identity:89/280 - (31%)
Similarity:149/280 - (53%) Gaps:31/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 VVVLIVSPVIIVL-----------VKNAAATIQLYALNLSQKAKELKREKRKSDSLLFQMLPPSV 475
            |.:..::|||:::           |::.|....|:.|..:.:.:|::..:..:..||..:||..|
Human   892 VALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDV 956

  Fly   476 AMQLKQTQQVPAELY----EAVTIYFSDIVGFT----EIAADCTPLEVVTFLNSIYRVFDERI-- 530
            |......::...|||    |.|.:.|:.|..|:    |:.|:...:|.:..||.|...|||.|  
Human   957 AAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISE 1021

  Fly   531 -ECYDVYKVETIGDSYMVASGLPVKN----GNKHISEIATMALDLLDASSVFRIPRAGDEFVQIR 590
             ....:.|::|||.:||.||||....    |..||:.:|..|:.|::  .:..|........|::
Human  1022 ERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLME--QMKHINEHSFNNFQMK 1084

  Fly   591 CGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGL 655
            .|::.||||||::|.:.|:|.::|:|||.:|||:|||...:|.:|.:::..| ...|::.|.||:
Human  1085 IGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVL-AAKGYQLECRGV 1148

  Fly   656 IDVKGKGLMSTYWLTCKDGP 675
            :.|||||.|:||:|  ..||
Human  1149 VKVKGKGEMTTYFL--NGGP 1166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 10/39 (26%)
CYCc 459..647 CDD:214485 65/202 (32%)
Guanylate_cyc 485..669 CDD:278633 71/198 (36%)
ADCY6NP_001377760.1 AC_N <16..368 CDD:318454
Guanylate_cyc 370..554 CDD:306677
DUF1053 582..668 CDD:399378
Guanylate_cyc 970..1164 CDD:306677 71/198 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.