DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and ADCY3

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_011530791.1 Gene:ADCY3 / 109 HGNCID:234 Length:1186 Species:Homo sapiens


Alignment Length:267 Identity:81/267 - (30%)
Similarity:141/267 - (52%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 VKNAAATIQLYALNLSQKAKELKREKRKSDSLLFQMLPPSVAMQL----KQTQQVPAELYEAVTI 495
            |:..|.|:.|:.:.:..:.:.:...:|.:::|:..|||..||...    |:.:::.::.|:.:.:
Human   902 VEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQTYDEIGV 966

  Fly   496 YFSDIVGF----TEIAADCTPLEVVTFLNSIYRVFDERIE---CYDVYKVETIGDSYMVASGL-P 552
            .|:.:..|    ||.:.:...:|.:.|||.|...||..::   ...:.|::|||.:||.|||: |
Human   967 MFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAASGVTP 1031

  Fly   553 VKNGN----------------KHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAG 601
            ..|.|                :|::::|..||.:.|  ::..|.........:|.|::.|.|:||
Human  1032 DVNTNGFASSNKEDKSERERWQHLADLADFALAMKD--TLTNINNQSFNNFMLRIGMNKGGVLAG 1094

  Fly   602 IVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMST 666
            ::|.:.|.|.::|:|||.||||||||....|.:.||....|::. |||...||.|.|||||.:.|
Human  1095 VIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREY-GFRFVRRGPIFVKGKGELLT 1158

  Fly   667 YWLTCKD 673
            ::|..:|
Human  1159 FFLKGRD 1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 10/39 (26%)
CYCc 459..647 CDD:214485 63/215 (29%)
Guanylate_cyc 485..669 CDD:278633 67/207 (32%)
ADCY3XP_011530791.1 AC_N <44..303 CDD:292831
CYCc 273..490 CDD:214485
Guanylate_cyc 310..516 CDD:278633
CYCc 925..1143 CDD:214485 66/220 (30%)
Guanylate_cyc 956..1163 CDD:278633 68/209 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.