DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and ADCY1

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_066939.1 Gene:ADCY1 / 107 HGNCID:232 Length:1119 Species:Homo sapiens


Alignment Length:337 Identity:98/337 - (29%)
Similarity:160/337 - (47%) Gaps:70/337 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 PVIIVLVKNAAATIQ------------LYALNLSQKAKELKREKRKSDSLLFQMLPPSVA----M 477
            |::.:|:.:.|..:.            |:|....::.:::::.|..:..:||.:||..||    |
Human   787 PIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNLLPAHVAQHFLM 851

  Fly   478 QLKQTQQVPAELYEAVTIYFSDIVGFT----EIAADCTPLEVVTFLNSIYRVFDERIE---CYDV 535
            ...:...:..:.|..|.:.|:.|..|.    |:..:...:|.:..||.|...|||.:|   ..|:
Human   852 SNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKDFYKDI 916

  Fly   536 YKVETIGDSYMVASGLPVKNGNK-------HISEIATMALDLLDASSVFRIPRAGDEFVQIRCGV 593
            .|::|||.:||.|.||...:|.|       |:|.:|..|:::.|....... ::.::|| :|.|:
Human   917 EKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEINY-QSYNDFV-LRVGI 979

  Fly   594 HTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDV 658
            :.||||||::|.:.|:|.::|:|||.||||:|||...:|.:|||:|..|::. .:....||.:.|
Human   980 NVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRC-PYHFVCRGKVSV 1043

  Fly   659 KGKGLMSTYWL-------------------TCKDG---------PVRAREEISWRADIQPVFLDH 695
            ||||.|.||:|                   .|..|         ||.....:|.||.:.|     
Human  1044 KGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRRPPVCPMPGVSVRAGLPP----- 1103

  Fly   696 LKLHPPTDYKLP 707
               |.|..| ||
Human  1104 ---HSPGQY-LP 1111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 11/55 (20%)
CYCc 459..647 CDD:214485 69/205 (34%)
Guanylate_cyc 485..669 CDD:278633 71/197 (36%)
ADCY1NP_066939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AC_N <161..292 CDD:292831
CYCc 258..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 493..520
CYCc 826..1037 CDD:214485 69/213 (32%)
Guanylate_cyc 859..1056 CDD:278633 72/199 (36%)
Interaction with calmodulin. /evidence=ECO:0000250 1024..1047 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.