DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Adcy4

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001348533.1 Gene:Adcy4 / 104110 MGIID:99674 Length:1077 Species:Mus musculus


Alignment Length:244 Identity:82/244 - (33%)
Similarity:131/244 - (53%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 KELKREKRKSDS-------LLFQMLPPSVAMQL----KQTQQVPAELYEAVTIYFSDIVGFTEIA 507
            |:|::|:.::::       ||..:||..||.|.    ::.:.:..:.||.|.:.|:.:..|.|..
Mouse   824 KKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFY 888

  Fly   508 ADCT----PLEVVTFLNSIYRVFDERI---ECYDVYKVETIGDSYMVASGLPVKNGN-------- 557
            ::..    .||.:..||.|...|||.:   :...|.|::|||.:||.|:||...:|.        
Mouse   889 SESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDSER 953

  Fly   558 --KHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTA 620
              .|:..:...|:.|  .|.:..|.:......::|.|::.||||||::|.:.|:|.::|:|||.|
Mouse   954 SCSHLGTMVEFAVAL--GSKLGVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVA 1016

  Fly   621 SRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWL 669
            |||||||...||.:|||...:||.: |:....||.|.|||||.:.||:|
Mouse  1017 SRMESTGVLGKIQVTEETARALQSL-GYTCYSRGSIKVKGKGELCTYFL 1064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 9/31 (29%)
CYCc 459..647 CDD:214485 68/215 (32%)
Guanylate_cyc 485..669 CDD:278633 71/200 (36%)
Adcy4NP_001348533.1 AC_N <115..246 CDD:318454
Guanylate_cyc 264..418 CDD:306677
DUF1053 479..580 CDD:368844
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..524
Guanylate_cyc 866..1065 CDD:306677 72/202 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.