DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and adcy1

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_002933461.1 Gene:adcy1 / 100492373 XenbaseID:XB-GENE-950909 Length:1122 Species:Xenopus tropicalis


Alignment Length:306 Identity:93/306 - (30%)
Similarity:155/306 - (50%) Gaps:52/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 IAILVVVLI------------------VSPVIIVLVKNAAATIQ------------LYALNLSQK 452
            :.||.:|::                  ..|::.:|:.:.:..:.            |:|:...::
 Frog   749 VTILYIVILEISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEE 813

  Fly   453 AKELKREKRKSDSLLFQMLPPSVA----MQLKQTQQVPAELYEAVTIYFSDIVGFT----EIAAD 509
            ..:::|.|..:..:||.:||..||    |...:...:..:.|..|.:.|:.|..|.    |:..:
 Frog   814 RDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGN 878

  Fly   510 CTPLEVVTFLNSIYRVFDERI--ECY-DVYKVETIGDSYMVASGLPVKNGNK-------HISEIA 564
            ...:|.:..||.|...|||.:  ||| |:.|::|||.:||.|.||....|.|       |:|.:|
 Frog   879 NMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLA 943

  Fly   565 TMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEA 629
            ..::::.|....... ::.:||| :|.|::.||||||::|.:.|:|.::|:|||.||||:|||..
 Frog   944 DFSIEMFDVLDEINY-QSYNEFV-LRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ 1006

  Fly   630 QKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCK-DG 674
            .||.:||::|..|:.. .:....||.:.|||||.|.||:|..| ||
 Frog  1007 GKIQVTEDVHRILKSC-NYEFVCRGKVSVKGKGEMLTYFLEGKIDG 1051

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 11/55 (20%)
CYCc 459..647 CDD:214485 71/205 (35%)
Guanylate_cyc 485..669 CDD:278633 73/197 (37%)
adcy1XP_002933461.1 AC_N <37..282 CDD:292831
CYCc 248..443 CDD:214485
Guanylate_cyc 284..466 CDD:278633
CYCc 817..1028 CDD:214485 72/213 (34%)
Guanylate_cyc 850..1047 CDD:278633 74/199 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.