Sequence 1: | NP_001033958.1 | Gene: | CG33958 / 37088 | FlyBaseID: | FBgn0053958 | Length: | 710 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002666572.2 | Gene: | LOC100333871 / 100333871 | -ID: | - | Length: | 243 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 117/203 - (57%) |
---|---|---|---|
Similarity: | 146/203 - (71%) | Gaps: | 0/203 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 470 MLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYD 534
Fly 535 VYKVETIGDSYMVASGLPVKNGNKHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVV 599
Fly 600 AGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLM 664
Fly 665 STYWLTCK 672 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33958 | NP_001033958.1 | NIT | 159..396 | CDD:285564 | |
HNOBA | <439..479 | CDD:285003 | 5/8 (63%) | ||
CYCc | 459..647 | CDD:214485 | 101/176 (57%) | ||
Guanylate_cyc | 485..669 | CDD:278633 | 108/183 (59%) | ||
LOC100333871 | XP_002666572.2 | CYCc | 1..179 | CDD:214485 | 102/177 (58%) |
Guanylate_cyc | 16..202 | CDD:278633 | 110/185 (59%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0009002 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |