DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and LOC100333871

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_002666572.2 Gene:LOC100333871 / 100333871 -ID:- Length:243 Species:Danio rerio


Alignment Length:203 Identity:117/203 - (57%)
Similarity:146/203 - (71%) Gaps:0/203 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 MLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYD 534
            |||..||..|:..:.:.|:.|.:.|::||||||||::::..||.:||.|||.:|..|||.|:.:|
Zfish     1 MLPKQVADDLRLGKPMQAQSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDEIIDNHD 65

  Fly   535 VYKVETIGDSYMVASGLPVKNGNKHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVV 599
            |||||||||:|||.||:|.:||..|.||||.|||||:.....||||......:|||.|:|:||||
Zfish    66 VYKVETIGDAYMVVSGVPRENGILHASEIANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVV 130

  Fly   600 AGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLM 664
            ||:||||||||||||||||||||||||.||.||..:......|:::||:....|||:.|||||.|
Zfish   131 AGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAFYLLEEIGGYLLTCRGLLQVKGKGDM 195

  Fly   665 STYWLTCK 672
            .||||..|
Zfish   196 VTYWLEGK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 5/8 (63%)
CYCc 459..647 CDD:214485 101/176 (57%)
Guanylate_cyc 485..669 CDD:278633 108/183 (59%)
LOC100333871XP_002666572.2 CYCc 1..179 CDD:214485 102/177 (58%)
Guanylate_cyc 16..202 CDD:278633 110/185 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009002
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.