Sequence 1: | NP_001033958.1 | Gene: | CG33958 / 37088 | FlyBaseID: | FBgn0053958 | Length: | 710 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009290254.2 | Gene: | gucy1a2 / 100330875 | ZFINID: | ZDB-GENE-121023-3 | Length: | 608 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 82/200 - (41%) |
---|---|---|---|
Similarity: | 123/200 - (61%) | Gaps: | 3/200 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 449 LSQKAKELKREKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVGFTEIAADCTPL 513
Fly 514 EVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMALDLLDASSVFR 578
Fly 579 IPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQ 643
Fly 644 QVGGF 648 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33958 | NP_001033958.1 | NIT | 159..396 | CDD:285564 | |
HNOBA | <439..479 | CDD:285003 | 10/29 (34%) | ||
CYCc | 459..647 | CDD:214485 | 79/187 (42%) | ||
Guanylate_cyc | 485..669 | CDD:278633 | 69/163 (42%) | ||
gucy1a2 | XP_009290254.2 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D531253at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |