DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and gucy1a2

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_009290254.2 Gene:gucy1a2 / 100330875 ZFINID:ZDB-GENE-121023-3 Length:608 Species:Danio rerio


Alignment Length:200 Identity:82/200 - (41%)
Similarity:123/200 - (61%) Gaps:3/200 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 LSQKAKELKREKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVGFTEIAADCTPL 513
            |.:..:.|:.|||::..||:.:.|..||.:|.|...|.|:.::.||:.||||||||.:.|.|||:
Zfish   351 LEKTHQALEEEKRRTVDLLYSIFPGDVAQRLWQGLPVQAKKFDDVTMLFSDIVGFTAVCAQCTPM 415

  Fly   514 EVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMALDLLDASSVFR 578
            :|::.||.:|..||.:....||||:|||||:|.||.||..|. :.|...||.|||.:::.|....
Zfish   416 QVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHRKI-DSHAKPIALMALKMMELSEEVL 479

  Fly   579 IPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQ 643
            .|  ..:.:::|.|:|:|.|:||:||..||||||||:.|..||:.||....:.|:::...:..|:
Zfish   480 TP--DGKPIKLRIGIHSGSVLAGVVGVMMPRYCLFGNNVTLASKFESGSHPRCINVSPTTYQLLR 542

  Fly   644 QVGGF 648
            ....|
Zfish   543 DDRSF 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 10/29 (34%)
CYCc 459..647 CDD:214485 79/187 (42%)
Guanylate_cyc 485..669 CDD:278633 69/163 (42%)
gucy1a2XP_009290254.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D531253at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.