DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nopo and AT1G80400

DIOPT Version :10

Sequence 1:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_178156.1 Gene:AT1G80400 / 844380 AraportID:AT1G80400 Length:407 Species:Arabidopsis thaliana


Alignment Length:45 Identity:17/45 - (37%)
Similarity:29/45 - (64%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNK 49
            :|.||...:|..::|....|.|:||.:|:::||..:.|||.|:|:
plant   354 SCCICLTRYGDDEQVRELPCSHVFHVDCVDKWLKINATCPLCKNE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nopoNP_611305.1 RING-H2_TRAIP 5..47 CDD:438143 15/41 (37%)
SMC_N <75..>255 CDD:481474
AT1G80400NP_178156.1 COG5540 <275..399 CDD:227827 17/45 (38%)
RING_Ubox 354..399 CDD:473075 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.