DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nopo and RHA1A

DIOPT Version :10

Sequence 1:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_192876.1 Gene:RHA1A / 826739 AraportID:AT4G11370 Length:159 Species:Arabidopsis thaliana


Alignment Length:47 Identity:20/47 - (42%)
Similarity:29/47 - (61%) Gaps:3/47 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CVICAELFGQADEV-FATVCGHMFHHNCLNQWL-DRSK-TCPQCRNK 49
            |.:|...|...|:| ....|||:|||.||::|: |.:| .||.||::
plant    86 CTVCLSDFESDDKVRQLPKCGHVFHHYCLDRWIVDYNKMKCPVCRHR 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nopoNP_611305.1 RING-H2_TRAIP 5..47 CDD:438143 18/43 (42%)
SMC_N <75..>255 CDD:481474
RHA1ANP_192876.1 RING-H2_RHA1-like 83..133 CDD:438483 20/47 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.