DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nopo and AT3G30460

DIOPT Version :10

Sequence 1:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_189667.2 Gene:AT3G30460 / 822758 AraportID:AT3G30460 Length:183 Species:Arabidopsis thaliana


Alignment Length:49 Identity:16/49 - (32%)
Similarity:22/49 - (44%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRN 54
            |.||.|.....:.:....|.|.:|..|::.||....|||.||:.....|
plant   133 CAICREELAANERLSELPCRHYYHKECISNWLSNRNTCPLCRHNVELPN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nopoNP_611305.1 RING-H2_TRAIP 5..47 CDD:438143 13/40 (33%)
SMC_N <75..>255 CDD:481474
AT3G30460NP_189667.2 RING-H2_PA-TM-RING 132..174 CDD:438118 13/40 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.