DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nopo and AT3G13228

DIOPT Version :10

Sequence 1:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_566449.1 Gene:AT3G13228 / 820519 AraportID:AT3G13228 Length:325 Species:Arabidopsis thaliana


Alignment Length:42 Identity:16/42 - (38%)
Similarity:20/42 - (47%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCR 47
            |.||.|.|.....:.|..|||.|...|..:|.:.:..||.||
plant   275 CTICLEEFNAGGILVALPCGHDFDDECAVKWFETNHFCPLCR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nopoNP_611305.1 RING-H2_TRAIP 5..47 CDD:438143 14/40 (35%)
SMC_N <75..>255 CDD:481474
AT3G13228NP_566449.1 RING_Ubox 273..319 CDD:473075 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.