DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nopo and CG10916

DIOPT Version :9

Sequence 1:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:63 Identity:33/63 - (52%)
Similarity:44/63 - (69%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LNLNCVICAELFGQADEVFATV-CGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFNLA 63
            ||:.|.||.|.|...|.:|:|. |||:||.:||.:||:||:||||||:.|..|.:.|:|.|.|
  Fly    28 LNILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFA 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nopoNP_611305.1 zf-RING_2 5..47 CDD:290367 23/42 (55%)
zf-rbx1 <5..47 CDD:289448 23/42 (55%)
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 23/41 (56%)
zf-rbx1 <32..74 CDD:289448 23/41 (56%)
DM9 105..183 CDD:128937
DUF3421 133..246 CDD:288732
DM9 186..254 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11118
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103318at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14186
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3349
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.