DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nopo and CG10916

DIOPT Version :10

Sequence 1:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_611303.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:63 Identity:33/63 - (52%)
Similarity:44/63 - (69%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LNLNCVICAELFGQADEVFATV-CGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFNLA 63
            ||:.|.||.|.|...|.:|:|. |||:||.:||.:||:||:||||||:.|..|.:.|:|.|.|
  Fly    28 LNILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFA 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nopoNP_611305.1 RING-H2_TRAIP 5..47 CDD:438143 23/42 (55%)
SMC_N <75..>255 CDD:481474
CG10916NP_611303.1 RING-H2_TRAIP 31..74 CDD:438143 23/42 (55%)
DUF3421 135..247 CDD:463390
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.