DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nopo and Rnf11

DIOPT Version :10

Sequence 1:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster


Alignment Length:41 Identity:19/41 - (46%)
Similarity:24/41 - (58%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQC 46
            ||||...|...:.|....|.|::|.||::.||.||.|||.|
  Fly    92 CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSC 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nopoNP_611305.1 RING-H2_TRAIP 5..47 CDD:438143 19/41 (46%)
SMC_N <75..>255 CDD:481474
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 19/41 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.