DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nopo and CG4325

DIOPT Version :9

Sequence 1:	NP_611305.1	Gene:	nopo / 37083	FlyBaseID:	FBgn0034314	Length:	435	Species:	Drosophila melanogaster
Sequence 2:	NP_001259169.1	Gene:	CG4325 / 31167	FlyBaseID:	FBgn0026878	Length:	158	Species:	Drosophila melanogaster

Alignment Length:	60	Identity:	25/60 - (41%)
Similarity:	35/60 - (58%)	Gaps:	6/60 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 NLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFNL 62
            |:.|.||:|.|..:|.:.|..|||.||.:||:.|..:|:|||.||::..      .||.|
  Fly     5 NVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDA------AYFQL 58

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nopo	NP_611305.1	zf-RING_2	5..47	CDD:290367	19/41 (46%)
nopo	NP_611305.1	zf-rbx1	<5..47	CDD:289448	19/41 (46%)
CG4325	NP_001259169.1	zf-RING_2	8..49	CDD:290367	19/40 (48%)
CG4325	NP_001259169.1	Prefoldin	112..>151	CDD:298833
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	53	1.000	Domainoid score	I11352
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D103393at6960
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR46569
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	4	4.020