DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nopo and Ring1

DIOPT Version :9

Sequence 1:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_033092.3 Gene:Ring1 / 19763 MGIID:1101770 Length:406 Species:Mus musculus


Alignment Length:55 Identity:16/55 - (29%)
Similarity:25/55 - (45%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNCVICAELFGQADEVFATVCGHMFHHNCLNQWL-DRSKTCPQCRNKCTTRNIFR 57
            |.|.||.::.  .:.:....|.|.|..:|:...| ..:|.||.||.|..::...|
Mouse    46 LMCPICLDML--KNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLR 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nopoNP_611305.1 zf-RING_2 5..47 CDD:290367 11/42 (26%)
zf-rbx1 <5..47 CDD:289448 11/42 (26%)
Ring1NP_033092.3 Necessary for transcriptional repression 30..234 16/55 (29%)
zf-C3HC4 48..87 CDD:278524 11/40 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..263
Nuclear localization signal. /evidence=ECO:0000250 201..204
Necessary for interaction with CBX2. /evidence=ECO:0000269|PubMed:9312051 230..406
RAWUL 280..400 CDD:292824
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3349
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.