DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5726 and CTIF

DIOPT Version :9

Sequence 1:NP_611304.1 Gene:CG5726 / 37082 FlyBaseID:FBgn0034313 Length:766 Species:Drosophila melanogaster
Sequence 2:XP_005258449.1 Gene:CTIF / 9811 HGNCID:23925 Length:616 Species:Homo sapiens


Alignment Length:343 Identity:72/343 - (20%)
Similarity:135/343 - (39%) Gaps:75/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSNTTSYGNNSYNNSAVDSGHSSHSGVGS----------------GGGGE--------------- 51
            :..|.:..|....::|.|:||||.....|                .||.|               
Human   287 AKETMTIENPKLEDTAGDTGHSSLEAPRSPDTLAPVASERLPPQQSGGPEVETKRKDSILPERIG 351

  Fly    52 ---------GTGARLR--------DVCTILNTGPAAYQNQTGGYAYDHIIALMRNLDLQDDGIVL 99
                     .:..|||        |...:..|.|  .||:     .|.:|.::.:  ::::...:
Human   352 ERPKITLLQSSKDRLRRRLKEKVPDEVAVETTTP--QQNK-----MDKLIEILNS--MRNNSSDV 407

  Fly   100 NSKIKTIETDFCNIVRDESMLCESMEYLNDKALSDGDTALKFALLFSSRNFDALAMKE-TKVRSA 163
            ::|:.|...:..|....|.||.|.:..:..||:||...|...|.|....   ||.|.| ||.||.
Human   408 DTKLTTFMEEAQNSTNSEEMLGEIVRTIYQKAVSDRSFAFTAAKLCDKM---ALFMVEGTKFRSL 469

  Fly   164 MLKILETNFLNADAYRLHDKNRLYNSITLLGEYYHRVRLADNTPITIL----GESLLDLL-TREL 223
            :|.:|:.:|...:..:..|..|....||.|.|.:..:|.:...|..:|    ...|.:|| ::::
Human   470 LLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRSSTGEPFRVLVCPIYTCLRELLQSQDV 534

  Fly   224 NDTSVVLGTRIARLVLSQITLNGEIMRKRHKVEIDLLLFHVRRHLIMQPALTAKVKAMLLMVLDL 288
            .:.:|:..:       .::...|.::.::....:..||...|..::. |:.:...:::||.|::|
Human   535 KEDAVLCCS-------MELQSTGRLLEEQLPEMMTELLASARDKMLC-PSESMLTRSLLLEVIEL 591

  Fly   289 FYSHFKHIGHDLETMYTN 306
            ..:.:..:...: |.|.|
Human   592 HANSWNPLTPPI-TQYYN 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5726NP_611304.1 None
CTIFXP_005258449.1 MIF4G 394..595 CDD:280935 48/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3942
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23254
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.