DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5726 and MIF4GD

DIOPT Version :9

Sequence 1:NP_611304.1 Gene:CG5726 / 37082 FlyBaseID:FBgn0034313 Length:766 Species:Drosophila melanogaster
Sequence 2:XP_016880377.1 Gene:MIF4GD / 57409 HGNCID:24030 Length:345 Species:Homo sapiens


Alignment Length:169 Identity:32/169 - (18%)
Similarity:62/169 - (36%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CTILNTGPAAYQNQTGGY-----AYDHIIALMR---NLDLQDDGIVLNSKIKTIETDFCNIVRDE 117
            ||:     |.::.:.|.|     :|.:...||.   |...:|.|.|...|:       .|::.|.
Human   101 CTV-----ACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKV-------ANVIVDH 153

  Fly   118 SMLCESMEYLNDKALSDGDTALKFALLFSSRNFDALAMKETKVRSAMLKILETNFLNADAYRLHD 182
            |        |.|...|.....:.:|::    ..::....::..|..:|..|:..:...:..|...
Human   154 S--------LQDCVFSKEAGRMCYAII----QAESKQAGQSVFRRGLLNRLQQEYQAREQLRARS 206

  Fly   183 KNRLYNSITLLGEYYHRVRLADNTPITILGESLLDLLTR 221
            .......:|.:...:..:|: :|.|:..|...:.|.|.|
Human   207 LQGWVCYVTFICNIFDYLRV-NNMPMMALVNPVYDCLFR 244



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23254
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.