DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5726 and Mif4gd

DIOPT Version :9

Sequence 1:NP_611304.1 Gene:CG5726 / 37082 FlyBaseID:FBgn0034313 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_001014144.1 Gene:Mif4gd / 360659 RGDID:1309685 Length:222 Species:Rattus norvegicus


Alignment Length:196 Identity:36/196 - (18%)
Similarity:78/196 - (39%) Gaps:21/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LQDDGIVLNSKIKTIETDFCNIVRDESMLCESMEYLNDKALSDGDTALKFALLFSSRNFDALAMK 156
            |:|.|.|...::       .|::.|.|        |.|...|.....:.:|::    ..::....
  Rat    26 LKDPGAVDLERV-------ANVIVDHS--------LQDCVFSKEAGRMCYAII----QAESKQAG 71

  Fly   157 ETKVRSAMLKILETNFLNADAYRLHDKNRLYNSITLLGEYYHRVRLADNTPITILGESLLDLLTR 221
            ::..|..:|..|:..:...:..|..........:|.:...:..:|: :|.|:..|...:.|.|.:
  Rat    72 QSVFRRGLLNRLQKEYDAREQLRACSLQGWVCYVTFICNIFDYLRV-NNMPMMALVNPVYDCLFQ 135

  Fly   222 ELNDTSVVLGTRIARLVLSQITLNGEIMRKRHKVEIDLLLFHVRRHLIMQPALTAKVKAMLLMVL 286
            .....|:.....:..||| |:...||.:.|.:...:|.|...:|...::...|::..:.:||.::
  Rat   136 LAQPESLSREEEVDCLVL-QLHRVGEQLEKMNGQRMDELFILIRDGFLLPIDLSSLARLLLLEII 199

  Fly   287 D 287
            :
  Rat   200 E 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5726NP_611304.1 None
Mif4gdNP_001014144.1 MIF4G 8..179 CDD:413423 32/173 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3942
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23254
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.