DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5726 and Ctif

DIOPT Version :9

Sequence 1:NP_611304.1 Gene:CG5726 / 37082 FlyBaseID:FBgn0034313 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_958742.2 Gene:Ctif / 269037 MGIID:2685518 Length:623 Species:Mus musculus


Alignment Length:232 Identity:50/232 - (21%)
Similarity:107/232 - (46%) Gaps:20/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DHIIALMRNLDLQDDGIVLNSKIKTIETDFCNIVRDESMLCESMEYLNDKALSDGDTALKFALLF 145
            |.::.::.:  ::::...:::|:.:...:..|....|.||.|.:..:..||:||...|...|.|.
Mouse   398 DRLMEILNS--MRNNSSDVDAKLTSFMEEAQNSTNSEEMLGEIVRTIYQKAVSDRSFAFTAAKLC 460

  Fly   146 SSRNFDALAMKE-TKVRSAMLKILETNFLNADAYRLHDKNRLYNSITLLGEYYHRVRLADNTPIT 209
            ...   ||.|.| ||.||.:|.:|:.:|...:..:..|..|....||.|.|.:..:|.:...|..
Mouse   461 DKM---ALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRSSTGEPFR 522

  Fly   210 IL----GESLLDLL-TRELNDTSVVLGTRIARLVLSQITLNGEIMRKRHKVEIDLLLFHVRRHLI 269
            :|    ...|.:|| ::::.:.:|:..:       .::...|.::.::....:..||...|..::
Mouse   523 VLVCPIYTCLRELLQSQDVKEDAVLCCS-------MELQSTGRLLEEQLPEMMTELLASARDKML 580

  Fly   270 MQPALTAKVKAMLLMVLDLFYSHFKHIGHDLETMYTN 306
            . |:.:...:::||.|::|..:.:..:...: |.|.|
Mouse   581 C-PSESMLTRSLLLEVIELHANSWNPLTPPI-TQYYN 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5726NP_611304.1 None
CtifNP_958742.2 PTZ00449 <259..>395 CDD:185628
MIF4G 402..602 CDD:397130 46/212 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3942
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23254
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.