DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and PJA2

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_055634.3 Gene:PJA2 / 9867 HGNCID:17481 Length:708 Species:Homo sapiens


Alignment Length:94 Identity:28/94 - (29%)
Similarity:37/94 - (39%) Gaps:29/94 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CAI-CNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAPEF 95
            |.| |:|:.:  |.|.:...|.|.|||.|::.||.:|.|||.|     ||......:..:.||  
Human   634 CPICCSEYIK--DDIATELPCHHFFHKPCVSIWLQKSGTCPVC-----RRHFPPAVIEASAAP-- 689

  Fly    96 DDTELPKVAMDWVPIDLDRDSLPDAHLPP 124
                               .|.||...||
Human   690 -------------------SSEPDPDAPP 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 18/42 (43%)
zf-rbx1 <32..74 CDD:289448 18/42 (43%)
DM9 105..183 CDD:128937 5/20 (25%)
DUF3421 133..246 CDD:288732
DM9 186..254 CDD:128937
PJA2NP_055634.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..317
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..495
Interaction with PRKAR1A, PRKAR2A and PRKAR2B. /evidence=ECO:0000269|PubMed:21423175 531..708 28/94 (30%)
zf-RING_2 634..675 CDD:290367 19/47 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..708 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.