DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10916 and PCGF1

DIOPT Version :9

Sequence 1:	NP_001261070.1	Gene:	CG10916 / 37081	FlyBaseID:	FBgn0034312	Length:	263	Species:	Drosophila melanogaster
Sequence 2:	NP_116062.2	Gene:	PCGF1 / 84759	HGNCID:	17615	Length:	259	Species:	Homo sapiens

Alignment Length:	133	Identity:	31/133 - (23%)
Similarity:	52/133 - (39%)	Gaps:	22/133 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    29 NILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCR------DPCDRRRVHRLY- 86
            :|:|.:|..:|.....|   :.|.|.|.|.|:.::|..|:.||.|.      .|....::.|:.
Human    44 HIVCCLCAGYFVDATTI---TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQ 105

  Fly    87 -LNFAEAPEFDDTELPKVAMDWVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLP----TYVARGYY 146
             :.:...|...|:|..::...:....|||.:.|....|       ..:..|||    .:....||
Human   106 DIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEP-------ALSNLGLPFSSFDHSKAHYY 163

  Fly   147 HDD 149
            ..|
Human   164 RYD 166

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10916	NP_001261070.1	zf-RING_2	32..74	CDD:290367	13/41 (32%)
		zf-rbx1	<32..74	CDD:289448	13/41 (32%)
		DM9	105..183	CDD:128937	11/49 (22%)
		DUF3421	133..246	CDD:288732	6/21 (29%)
		DM9	186..254	CDD:128937
PCGF1	NP_116062.2	RING-HC_PCGF1	44..86	CDD:319647	14/44 (32%)
		RING-HC finger (C3HC4-type)	47..85	CDD:319647	13/40 (33%)
		Required for repressor activity	86..247		16/88 (18%)
		Required for the interaction with the KDM2B-SKP1 heterodimeric complex. /evidence=ECO:0000269\|PubMed:27568929	150..255		5/17 (29%)
		RAWUL_PCGF1	166..253	CDD:340601	1/1 (100%)
		RING-finger and WD40-associated ubiquitin-like domain (RAWUL), sufficient for interaction with BCOR and BCORL1. /evidence=ECO:0000269\|PubMed:23523425, ECO:0000269\|PubMed:27568929	167..255		31/133 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000