DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10916 and RNF2

DIOPT Version :9

Sequence 1:	NP_001261070.1	Gene:	CG10916 / 37081	FlyBaseID:	FBgn0034312	Length:	263	Species:	Drosophila melanogaster
Sequence 2:	NP_009143.1	Gene:	RNF2 / 6045	HGNCID:	10061	Length:	336	Species:	Homo sapiens

Alignment Length:	68	Identity:	18/68 - (26%)
Similarity:	29/68 - (42%)	Gaps:	10/68 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 ILCAICNEFFRANDIIFSTSRCGHVFHKDC-LTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAP 93
            ::|.||.:..:..   .:|..|.|.|..|| :|...:.::.||.||.....:|      :....|
Human    49 LMCPICLDMLKNT---MTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKR------SLRPDP 104

  Fly    94 EFD 96
            .||
Human   105 NFD 107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10916	NP_001261070.1	zf-RING_2	32..74	CDD:290367	12/42 (29%)
		zf-rbx1	<32..74	CDD:289448	12/42 (29%)
		DM9	105..183	CDD:128937
		DUF3421	133..246	CDD:288732
		DM9	186..254	CDD:128937
RNF2	NP_009143.1	Interaction with HIP2. /evidence=ECO:0000269\|PubMed:11513855	2..179		18/68 (26%)
		COG5222	<11..>103	CDD:227547	15/62 (24%)
		RING-HC_RING1_like	51..91	CDD:319445	12/42 (29%)
		Interaction with nucleosomes via an acidic patch on histone H2A and histone H2B. /evidence=ECO:0000269\|PubMed:25355358	93..98		0/4 (0%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	157..208
		RAWUL_RING2	225..330	CDD:340687
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3349
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940