DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and lnx1

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_005160562.1 Gene:lnx1 / 561226 ZFINID:ZDB-GENE-030131-9439 Length:769 Species:Danio rerio


Alignment Length:185 Identity:46/185 - (24%)
Similarity:71/185 - (38%) Gaps:58/185 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NILCAIC-NEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDP-----CDRRR--VHRL 85
            :::|.|| ....|..|     :.|||.:.::|||.:|..|..||..|.|     |.:..  ||:|
Zfish    54 DLMCHICLQPLIRPLD-----TPCGHTYCQECLTNFLLESDFCPVDRTPLMLQKCRKSSLLVHKL 113

  Fly    86 YLNFAEAPEFDD--TE-LPKVAMD-----------WVPIDLDR----------DSLPD---AHLP 123
            ......:..|.|  || :|:..|:           ...:..:|          ||..:   |.||
Zfish   114 LDKLMVSCPFADHCTEVMPRGEMEGHIRCRCKGASHYGLSAERKRRSQEGDCTDSTSELTLAALP 178

  Fly   124 PEG----AVQCGTNEDGL--PTYVARGYYHDDLLPAPYVPEKKAAFGSHSCSART 172
            .||    |:...::|.||  |.|            .|.|.:...:..:.|.:||:
Zfish   179 GEGCPSSAIALLSDEPGLVNPAY------------EPSVEDNSQSGSTTSLAARS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 15/42 (36%)
zf-rbx1 <32..74 CDD:289448 15/42 (36%)
DM9 105..183 CDD:128937 20/98 (20%)
DUF3421 133..246 CDD:288732 10/42 (24%)
DM9 186..254 CDD:128937
lnx1XP_005160562.1 RING 57..93 CDD:214546 14/40 (35%)
PDZ_signaling 297..381 CDD:238492
PDZ_signaling 411..491 CDD:238492
PDZ_signaling 536..621 CDD:238492
DegQ <548..621 CDD:223343
PDZ_signaling 678..762 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3349
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.