DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and traip

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001017318.1 Gene:traip / 550072 XenbaseID:XB-GENE-922321 Length:463 Species:Xenopus tropicalis


Alignment Length:86 Identity:30/86 - (34%)
Similarity:48/86 - (55%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CAICNEFF-RANDIIFSTSRCGHVFHKDCLTRWLNRS--RTCPQCR-DPCDRRRVHRLYLNF-AE 91
            |.||::|| .:.|:...|  |||.||::||.:|.:.:  ||||||| ....|:.:::|:.:. .|
 Frog     7 CTICSDFFDNSRDVAAVT--CGHTFHQECLLQWFHSAPHRTCPQCRIQVSSRQIINKLFFDIGGE 69

  Fly    92 APEFDDTELPKVAMDWVPIDL 112
            .....|.|..|..:|.:.:.|
 Frog    70 EETVLDPESLKNEVDRIKVSL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 20/44 (45%)
zf-rbx1 <32..74 CDD:289448 20/44 (45%)
DM9 105..183 CDD:128937 2/8 (25%)
DUF3421 133..246 CDD:288732
DM9 186..254 CDD:128937
traipNP_001017318.1 RING-H2_TRAIP 6..50 CDD:319394 20/44 (45%)
RING-H2 finger (C3H2C3-type) 7..49 CDD:319394 19/43 (44%)
Smc <69..>275 CDD:224117 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D581741at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3349
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.