DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and CG6923

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster


Alignment Length:43 Identity:17/43 - (39%)
Similarity:24/43 - (55%) Gaps:1/43 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCR 74
            ||||...|...:.: ....|.|:||.||:.:||..::.||.||
  Fly  1187 CAICLNLFEIENEV-RRLPCMHLFHTDCVDQWLVTNKHCPICR 1228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 15/41 (37%)
zf-rbx1 <32..74 CDD:289448 15/41 (37%)
DM9 105..183 CDD:128937
DUF3421 133..246 CDD:288732
DM9 186..254 CDD:128937
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 15/41 (37%)
zf-RING_2 1187..1228 CDD:290367 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.