DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and rnf2

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_998872.1 Gene:rnf2 / 407872 XenbaseID:XB-GENE-981241 Length:336 Species:Xenopus tropicalis


Alignment Length:204 Identity:48/204 - (23%)
Similarity:72/204 - (35%) Gaps:50/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ILCAICNEFFRANDIIFSTSRCGHVFHKDC-LTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAP 93
            ::|.||.:..:..   .:|..|.|.|..|| :|...:.::.||.||.....:|..|...||    
 Frog    49 LMCPICLDMLKNT---MTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNF---- 106

  Fly    94 EFDDTELPKVAMDWVPIDLDRDSLPDAHLPPEGA-VQCGTNEDGLPTYVARGYYHDDL--LPAPY 155
               |..:.|:    .|   .||.. :||.....| :....|:..|...:..|.....|  ||...
 Frog   107 ---DALISKI----YP---SRDEY-EAHQERVLARINKHNNQQALSHSIEEGLKIQALNRLPRGK 160

  Fly   156 VPEKKAAFG-------SHSCSA-------------RTLTDDVEILVLNDCDYKWVPGQHGTYPRD 200
            .|:.:...|       ||..:|             ||.|.|...|.|:.        .:.|...|
 Frog   161 KPQVENGSGAEDNADSSHCSNASVHSNQEAGPSNKRTKTSDDSGLELDT--------NNETASMD 217

  Fly   201 ALNTGYSEL 209
            ::..|.||:
 Frog   218 SVLDGASEI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 12/42 (29%)
zf-rbx1 <32..74 CDD:289448 12/42 (29%)
DM9 105..183 CDD:128937 22/100 (22%)
DUF3421 133..246 CDD:288732 22/99 (22%)
DM9 186..254 CDD:128937 5/24 (21%)
rnf2NP_998872.1 COG5222 <10..>103 CDD:227547 16/56 (29%)
RING-HC_RING1_like 51..91 CDD:319445 12/42 (29%)
RING-HC finger (C3HC4-type) 51..90 CDD:319445 12/41 (29%)
RAWUL_RING2 225..330 CDD:340687 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3349
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.