Sequence 1: | NP_001261070.1 | Gene: | CG10916 / 37081 | FlyBaseID: | FBgn0034312 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998872.1 | Gene: | rnf2 / 407872 | XenbaseID: | XB-GENE-981241 | Length: | 336 | Species: | Xenopus tropicalis |
Alignment Length: | 204 | Identity: | 48/204 - (23%) |
---|---|---|---|
Similarity: | 72/204 - (35%) | Gaps: | 50/204 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 ILCAICNEFFRANDIIFSTSRCGHVFHKDC-LTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAP 93
Fly 94 EFDDTELPKVAMDWVPIDLDRDSLPDAHLPPEGA-VQCGTNEDGLPTYVARGYYHDDL--LPAPY 155
Fly 156 VPEKKAAFG-------SHSCSA-------------RTLTDDVEILVLNDCDYKWVPGQHGTYPRD 200
Fly 201 ALNTGYSEL 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10916 | NP_001261070.1 | zf-RING_2 | 32..74 | CDD:290367 | 12/42 (29%) |
zf-rbx1 | <32..74 | CDD:289448 | 12/42 (29%) | ||
DM9 | 105..183 | CDD:128937 | 22/100 (22%) | ||
DUF3421 | 133..246 | CDD:288732 | 22/99 (22%) | ||
DM9 | 186..254 | CDD:128937 | 5/24 (21%) | ||
rnf2 | NP_998872.1 | COG5222 | <10..>103 | CDD:227547 | 16/56 (29%) |
RING-HC_RING1_like | 51..91 | CDD:319445 | 12/42 (29%) | ||
RING-HC finger (C3HC4-type) | 51..90 | CDD:319445 | 12/41 (29%) | ||
RAWUL_RING2 | 225..330 | CDD:340687 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3349 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |