DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and CG5506

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:162 Identity:49/162 - (30%)
Similarity:72/162 - (44%) Gaps:16/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VPIDLDRDSLPDA----HLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAA-FGSHS 167
            ||...|.:.:..|    ::.|..||..|.:..|..|||.|..|.:.:|||..|.|...| |.:.:
  Fly    18 VPSTYDTEHVWKAGNLSYVIPYNAVVGGFDPYGFTTYVGRVKYSNSILPARVVAETGTAYFNTET 82

  Fly   168 CSARTLTDDVEILVLNDCDYKWVPGQHGTYPRDALNTGYSELGEVTY-----TGRGLYQGILRLG 227
            .|::.|..|: ::...|.:|.||....|.|.:.|:..|.:...|..:     |..|:..|.|.|.
  Fly    83 TSSKLLVYDI-LVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLLS 146

  Fly   228 KVHPSHKVMYIPHHGQEV-SVNTYEVLVVTPR 258
                |.||..|.|....: ..:.|||||..|:
  Fly   147 ----SQKVCIIKHESLALRKFDKYEVLVAQPK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367
zf-rbx1 <32..74 CDD:289448
DM9 105..183 CDD:128937 24/79 (30%)
DUF3421 133..246 CDD:288732 35/119 (29%)
DM9 186..254 CDD:128937 21/73 (29%)
CG5506NP_649021.1 DM9 25..96 CDD:128937 21/71 (30%)
DUF3421 47..161 CDD:288732 35/118 (30%)
DM9 100..172 CDD:128937 23/75 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.