DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10916 and rnf181

DIOPT Version :9

Sequence 1:	NP_001261070.1	Gene:	CG10916 / 37081	FlyBaseID:	FBgn0034312	Length:	263	Species:	Drosophila melanogaster
Sequence 2:	NP_956600.1	Gene:	rnf181 / 393276	ZFINID:	ZDB-GENE-040426-1024	Length:	156	Species:	Danio rerio

Alignment Length:	90	Identity:	25/90 - (27%)
Similarity:	38/90 - (42%)	Gaps:	20/90 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 IAETAPTNDSSP---SLNILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCR-- 74
            :.::.|....||   ...:.|.:|...|...:.: ....|.|:||..|:..|||::.:||.||
Zfish    59 VVQSLPVVIISPEQADKGVKCPVCLLEFEEQESV-REMPCKHLFHTGCILPWLNKTNSCPLCRLE 122

  Fly    75 ---DPCD-----------RRRVHRL 85
               |..|           |:|.|||
Zfish   123 LPTDNADYEEFKKDKERRRQREHRL 147

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10916	NP_001261070.1	zf-RING_2	32..74	CDD:290367	13/41 (32%)
		zf-rbx1	<32..74	CDD:289448	13/41 (32%)
		DM9	105..183	CDD:128937
		DUF3421	133..246	CDD:288732
		DM9	186..254	CDD:128937
rnf181	NP_956600.1	zf-RING_2	79..120	CDD:290367	13/41 (32%)
rnf181	NP_956600.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	135..156		5/13 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910