DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and gol

DIOPT Version :10

Sequence 1:NP_611303.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:43 Identity:20/43 - (46%)
Similarity:25/43 - (58%) Gaps:1/43 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCR 74
            ||||.|.::..|.| ....|.|.|||:|:..||...||||.|:
  Fly   303 CAICIEAYKPTDTI-RILPCKHEFHKNCIDPWLIEHRTCPMCK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_611303.1 RING-H2_TRAIP 31..74 CDD:438143 19/41 (46%)
DUF3421 135..247 CDD:463390
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 20/43 (47%)
RING-H2_RNF130-like 302..347 CDD:438330 20/43 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.