DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and CG10527

DIOPT Version :10

Sequence 1:NP_611303.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster


Alignment Length:153 Identity:44/153 - (28%)
Similarity:67/153 - (43%) Gaps:22/153 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 WVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAF-----GSH 166
            |||       ..:..:|| .|:: |..:.....|:||..:..||:|....|.....:     |.|
  Fly   159 WVP-------AANGEVPP-NALE-GGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEH 214

  Fly   167 SCSARTLTDDVEILVLNDCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHP 231
            .        ..|..||.....:|:|...|..|.:||..|.:..||..:.||..:.|.:.:|||.|
  Fly   215 G--------HAEYEVLCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQP 271

  Fly   232 SHKVMYIPHHGQEVSVNTYEVLV 254
            ||...|||:.|:|::...:|:.|
  Fly   272 SHGCCYIPYGGEELAYKEFEIYV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_611303.1 RING-H2_TRAIP 31..74 CDD:438143
DUF3421 135..247 CDD:463390 35/116 (30%)
CG10527NP_611544.1 Methyltransf_FA 34..132 CDD:463505
DUF3421 177..287 CDD:463390 35/117 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.