powered by:
Protein Alignment CG10916 and nopo
DIOPT Version :9
Sequence 1: | NP_001261070.1 |
Gene: | CG10916 / 37081 |
FlyBaseID: | FBgn0034312 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611305.1 |
Gene: | nopo / 37083 |
FlyBaseID: | FBgn0034314 |
Length: | 435 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 33/63 - (52%) |
Similarity: | 44/63 - (69%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 LNILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFA 90
||:.|.||.|.|...|.:|:|. |||:||.:||.:||:||:||||||:.|..|.:.|:|.|.|
Fly 2 LNLNCVICAELFGQADEVFATV-CGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFNLA 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I11118 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D103318at50557 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm14186 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3349 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.950 |
|
Return to query results.
Submit another query.