DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and Traip

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001102474.1 Gene:Traip / 367167 RGDID:1309761 Length:469 Species:Rattus norvegicus


Alignment Length:100 Identity:34/100 - (34%)
Similarity:51/100 - (51%) Gaps:13/100 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNILCAICNEFF-RANDIIFSTSRCGHVFHKDCLTRWLNR--SRTCPQCRDPCDRRR-VHRLYLN 88
            :..||.||::|| .:.|:  :...|||.||..||.:|...  ||||||||....::. :::|:.:
  Rat     3 IRALCTICSDFFDHSRDV--AAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKKTIINKLFFD 65

  Fly    89 FAEAPE-FDDTELPKVAMDWVPIDLD------RDS 116
            .|:..| ..|.|..|..:|.:...|.      |||
  Rat    66 LAQEEESVLDAEFLKNELDSIKAQLSQKDREKRDS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 20/44 (45%)
zf-rbx1 <32..74 CDD:289448 20/44 (45%)
DM9 105..183 CDD:128937 4/17 (24%)
DUF3421 133..246 CDD:288732
DM9 186..254 CDD:128937
TraipNP_001102474.1 zf-RING_2 7..50 CDD:290367 20/44 (45%)
BAR 106..>264 CDD:299863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11048
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D581741at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.