DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and Rnf150

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001178022.1 Gene:Rnf150 / 364983 RGDID:1304572 Length:437 Species:Rattus norvegicus


Alignment Length:192 Identity:53/192 - (27%)
Similarity:72/192 - (37%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEA---- 92
            ||:|.|.::.:|:: ....|.|:|||.|:..||...||||.|:            :|..:|    
  Rat   277 CAVCIEGYKPSDVV-RILPCRHLFHKSCVDPWLLDHRTCPMCK------------MNILKALGIP 328

  Fly    93 PEFDDTELPKVAMDWVPIDLDRDSLPDAHLPP----EGAVQCGTNEDGLP------TYVARGYYH 147
            |..|       .||.:|||.: .||..   ||    .||.....||..:.      |..|.....
  Rat   329 PNAD-------CMDDLPIDFE-GSLGG---PPTNQITGASDTTVNESSVTLDPAVRTVGALQVVQ 382

  Fly   148 DDLLPAPYVPEKKAAFGSHSCSARTLTDDVEILVLNDCDYKWVPGQHGTYPRDALNTGYSEL 209
            |   |.|...|.:|.|        |...|.|..|.:|.|...:.         ||..|.|::
  Rat   383 D---PDPAPQEGEAIF--------TTNSDQEPAVSSDSDISLIM---------ALEVGLSDV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 17/41 (41%)
zf-rbx1 <32..74 CDD:289448 17/41 (41%)
DM9 105..183 CDD:128937 25/87 (29%)
DUF3421 133..246 CDD:288732 20/83 (24%)
DM9 186..254 CDD:128937 5/24 (21%)
Rnf150NP_001178022.1 PA_GRAIL_like 45..192 CDD:239037
UPF0233 <206..>231 CDD:299753
zf-RING_2 275..318 CDD:290367 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.