DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and CG13321

DIOPT Version :10

Sequence 1:NP_611303.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_610831.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster


Alignment Length:136 Identity:57/136 - (41%)
Similarity:78/136 - (57%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAF---GSHSCSARTLTDDVEILVLN 183
            ||| ||:..|.:.|..|.:|.|.|::.::|||..||.|:.|:   |....|..    |.|:||.:
  Fly    15 LPP-GAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKH----DFEVLVGD 74

  Fly   184 DCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPHHGQEVSVN 248
              .:.|:|...|:.|..|:..|.:..||..|.|||.:||.|..|||||||:.:|||:.|||..:.
  Fly    75 --HFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLE 137

  Fly   249 TYEVLV 254
            .|||||
  Fly   138 AYEVLV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_611303.1 RING-H2_TRAIP 31..74 CDD:438143
DUF3421 135..247 CDD:463390 46/114 (40%)
CG13321NP_610831.1 DUF3421 26..135 CDD:463390 46/114 (40%)
DUF3421 168..277 CDD:463390
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.