DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and CG44251

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster


Alignment Length:134 Identity:46/134 - (34%)
Similarity:68/134 - (50%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGSHSCSARTLTDDV-EILVLNDC-- 185
            ||.||..|.:|||...||.|..:..|:|....||.|:..|.|....|  |..|: |:|    |  
  Fly    15 PEEAVVGGNDEDGAMIYVGRAEHEGDMLVCKVVPSKQLGFISQRGEA--LPKDIFEVL----CGQ 73

  Fly   186 DYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPHHGQEVSVNTY 250
            :..|:.......|.:|:..|.:.|.:..|.|||.|:|.|.:||:...|:.::|...|.|..:::|
  Fly    74 NLVWIKCYDHVIPENAVLCGRTSLDQPVYIGRGHYEGHLIIGKISSVHRALFIAFRGAERRLDSY 138

  Fly   251 EVLV 254
            |:||
  Fly   139 EILV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367
zf-rbx1 <32..74 CDD:289448
DM9 105..183 CDD:128937 23/59 (39%)
DUF3421 133..246 CDD:288732 37/115 (32%)
DM9 186..254 CDD:128937 20/67 (30%)
CG44251NP_725246.1 DM9 3..73 CDD:128937 24/63 (38%)
DUF3421 24..134 CDD:288732 37/115 (32%)
DM9 74..144 CDD:128937 22/69 (32%)
DM9 322..393 CDD:128937
DUF3421 344..455 CDD:288732
DM9 396..464 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.