DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and CG32633

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001259517.1 Gene:CG32633 / 326225 FlyBaseID:FBgn0052633 Length:285 Species:Drosophila melanogaster


Alignment Length:211 Identity:69/211 - (32%)
Similarity:100/211 - (47%) Gaps:39/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GHVFHKDCLTRW-LNRSRTCPQCRDPCDRRRVHRLYLNFAEAPEFDDTELPKVAMD-------WV 108
            |..:|...||.. ::.|..|              ||:      .:|..|:...|.:       | 
  Fly   104 GRGYHAGSLTMGKVHPSHGC--------------LYI------PYDSDEVKIFAYEVLC
QPERW- 147

  Fly   109 PIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGSHSCSARTL 173
             ||....::||      ||:..|.:.:|...||.|.:.:.|||||..||.|..|:.:::.:...|
  Fly   148 -IDTTATNIPD------GALVAGHDSNGDTIYVGRVFRNGDLLPAKVVPAKGKAYAAYAQAEHEL 205

  Fly   174 TDDVEILVLNDCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYI 238
            ||   :.||....::|||..||.....||::|.:..||..|.||.:|...|.:||:||||..:||
  Fly   206 TD---VQVLTGSGFRWVPASHGNVAPGALSSGPNVDGEPLYVGRAIYCDSLSVGKIHPSHGCIYI 267

  Fly   239 PHHGQEVSVNTYEVLV 254
            |..|:||.:..|||||
  Fly   268 PFGGEEVRLENYEVLV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 6/22 (27%)
zf-rbx1 <32..74 CDD:289448 6/22 (27%)
DM9 105..183 CDD:128937 25/84 (30%)
DUF3421 133..246 CDD:288732 44/112 (39%)
DM9 186..254 CDD:128937 30/67 (45%)
CG32633NP_001259517.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732 10/49 (20%)
DM9 74..142 CDD:128937 11/57 (19%)
DUF3421 165..275 CDD:288732 44/112 (39%)
DM9 215..284 CDD:128937 32/69 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.