DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and CG4325

DIOPT Version :10

Sequence 1:NP_611303.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster


Alignment Length:66 Identity:33/66 - (50%)
Similarity:42/66 - (63%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAP 93
            |::|.||:|.||.:|.|.:.| |||.||:|||..|..:|||||.||.  ......:|||:|.|.|
  Fly     5 NVICTICSERFRTSDNIQAGS-CGHAFHEDCLDHWRKQSRTCPICRS--QDAAYFQLYLDFEEFP 66

  Fly    94 E 94
            |
  Fly    67 E 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_611303.1 RING-H2_TRAIP 31..74 CDD:438143 23/42 (55%)
DUF3421 135..247 CDD:463390
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 23/42 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.