powered by:
Protein Alignment CG10916 and CG4325
DIOPT Version :9
Sequence 1: | NP_001261070.1 |
Gene: | CG10916 / 37081 |
FlyBaseID: | FBgn0034312 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001259169.1 |
Gene: | CG4325 / 31167 |
FlyBaseID: | FBgn0026878 |
Length: | 158 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 33/66 - (50%) |
Similarity: | 42/66 - (63%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 NILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAP 93
|::|.||:|.||.:|.|.:.| |||.||:|||..|..:|||||.||. ......:|||:|.|.|
Fly 5 NVICTICSERFRTSDNIQAGS-CGHAFHEDCLDHWRKQSRTCPICRS--QDAAYFQLYLDFEEFP 66
Fly 94 E 94
|
Fly 67 E 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I11352 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D103393at6960 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.