powered by:
Protein Alignment CG10916 and spat-3
DIOPT Version :9
Sequence 1: | NP_001261070.1 |
Gene: | CG10916 / 37081 |
FlyBaseID: | FBgn0034312 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001024904.2 |
Gene: | spat-3 / 259704 |
WormBaseID: | WBGene00020496 |
Length: | 2476 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 19/66 - (28%) |
Similarity: | 27/66 - (40%) |
Gaps: | 10/66 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 CAICNEFFRANDIIFSTSRCGHVFHKDC-LTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAPEF 95
|.:|.|..:.: ..|.:|||.|...| |..::....|||.||.....:| ...:.|.|
Worm 162 CDVCQELIQGS---IMTKKCGHRFCDQCILVAFMRSGNTCPTCRQNLGSKR------ELQQDPRF 217
Fly 96 D 96
|
Worm 218 D 218
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3349 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.