DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10916 and spat-3

DIOPT Version :9

Sequence 1:	NP_001261070.1	Gene:	CG10916 / 37081	FlyBaseID:	FBgn0034312	Length:	263	Species:	Drosophila melanogaster
Sequence 2:	NP_001024904.2	Gene:	spat-3 / 259704	WormBaseID:	WBGene00020496	Length:	2476	Species:	Caenorhabditis elegans

Alignment Length:	66	Identity:	19/66 - (28%)
Similarity:	27/66 - (40%)	Gaps:	10/66 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    32 CAICNEFFRANDIIFSTSRCGHVFHKDC-LTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAPEF 95
            |.:|.|..:.:   ..|.:|||.|...| |..::....|||.||.....:|      ...:.|.|
Worm   162 CDVCQELIQGS---IMTKKCGHRFCDQCILVAFMRSGNTCPTCRQNLGSKR------ELQQDPRF 217

  Fly    96 D 96
            |
Worm   218 D 218

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10916	NP_001261070.1	zf-RING_2	32..74	CDD:290367	13/42 (31%)
		zf-rbx1	<32..74	CDD:289448	13/42 (31%)
		DM9	105..183	CDD:128937
		DUF3421	133..246	CDD:288732
		DM9	186..254	CDD:128937
spat-3	NP_001024904.2	RING-HC_RNF138	158..203	CDD:319458	14/43 (33%)
		MSCRAMM_SdrD	<290..583	CDD:380149
		GREB1	<1301..>1430	CDD:374106
		PAT1	<1724..>1845	CDD:370676
		DUF1720	2150..>2199	CDD:369766
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3349
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030