DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and CG44250

DIOPT Version :10

Sequence 1:NP_611303.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster


Alignment Length:159 Identity:65/159 - (40%)
Similarity:86/159 - (54%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VAMD--WVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGS 165
            |.:|  ||      .|.|.:.|||. ||..|.:.|..|.||.|.::..:.|||..||.|..|:.:
  Fly    10 VTVDNTWV------HSSPYSPLPPY-AVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVA 67

  Fly   166 HSCSARTLTDDVEILVLNDCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVH 230
            :..:..|.| ..|:||  ...:.|||...|..|.:|:.:|.:..||..|.|||.:.|.|.:||||
  Fly    68 YGGAEHTKT-HYEVLV--GQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVH 129

  Fly   231 PSHKVMYIPHHGQEVSVNTYEVLVVTPRD 259
            |||..:|||..||||.:||||||:....|
  Fly   130 PSHGCLYIPFGGQEVRINTYEVLIKQQHD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_611303.1 RING-H2_TRAIP 31..74 CDD:438143
DUF3421 135..247 CDD:463390 46/111 (41%)
CG44250NP_001163133.1 DUF3421 36..146 CDD:463390 46/112 (41%)
DUF3421 179..288 CDD:463390
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.