DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10916 and Rlim

DIOPT Version :9

Sequence 1:	NP_001261070.1	Gene:	CG10916 / 37081	FlyBaseID:	FBgn0034312	Length:	263	Species:	Drosophila melanogaster
Sequence 2:	NP_001345134.1	Gene:	Rlim / 19820	MGIID:	1342291	Length:	600	Species:	Mus musculus

Alignment Length:	124	Identity:	31/124 - (25%)
Similarity:	42/124 - (33%)	Gaps:	53/124 - (42%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 ESNSSEMEGN--GGKIAET-------AP-TNDSSPSLNIL------------------------- 31
            ||:|...||:  ||....:       || |.|.|.||..|
Mouse   466 ESSSEMFEGSSEGGSSGPSRRDGRHRAPVTFDESGSLPFLSLAQFFLLNEDDEDQPRGLTKEQID 530

  Fly    32 ---------------CAIC-NEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCR 74
                           |::| .|:...|.:  ....|.|.:|..|:.|||:.:.|||.||
Mouse   531 NLAMRSFGENDALKTCSVCITEYTEGNKL--RKLPCSHEYHVHCIDRWLSENSTCPICR 587

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10916	NP_001261070.1	zf-RING_2	32..74	CDD:290367	14/42 (33%)
		zf-rbx1	<32..74	CDD:289448	14/42 (33%)
		DM9	105..183	CDD:128937
		DUF3421	133..246	CDD:288732
		DM9	186..254	CDD:128937
Rlim	NP_001345134.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..24
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	49..355
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	417..497		10/30 (33%)
		RING_Ubox	544..588	CDD:388418	16/46 (35%)
		PDZ-binding. /evidence=ECO:0000255	597..600
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910