DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and T22B2.1

DIOPT Version :9

Sequence 1:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_508680.1 Gene:T22B2.1 / 188716 WormBaseID:WBGene00020665 Length:955 Species:Caenorhabditis elegans


Alignment Length:91 Identity:20/91 - (21%)
Similarity:31/91 - (34%) Gaps:20/91 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KIAETAPTNDSSPSLNILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCD 78
            |:.||..:::....   .|.:|.|....|......|.|...:|..|:.:|....|.||.|     
 Worm   885 KLPETIKSDELDDK---ECLVCLEDMVKNQDTVKCSTCKRQYHTTCVQKWFKIKRICPTC----- 941

  Fly    79 RRRVHRLYLNFAEAPEFDDTELPKVA 104
                        .|...|:.|.|.::
 Worm   942 ------------NAGLLDENEFPALS 955

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 12/41 (29%)
zf-rbx1 <32..74 CDD:289448 12/41 (29%)
DM9 105..183 CDD:128937 20/91 (22%)
DUF3421 133..246 CDD:288732
DM9 186..254 CDD:128937
T22B2.1NP_508680.1 SMC_prok_A <620..>769 CDD:274009
zf-RING_2 899..942 CDD:372655 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.