powered by:
Protein Alignment CG10916 and ZK637.14
DIOPT Version :9
Sequence 1: | NP_001261070.1 |
Gene: | CG10916 / 37081 |
FlyBaseID: | FBgn0034312 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498962.1 |
Gene: | ZK637.14 / 176251 |
WormBaseID: | WBGene00014031 |
Length: | 161 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 21/63 - (33%) |
Similarity: | 25/63 - (39%) |
Gaps: | 20/63 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 CAIC----------------NEFFRANDIIFSTS----RCGHVFHKDCLTRWLNRSRTCPQCR 74
|||| .|..:.:...|.|: .|.|.||..|||.||...:|||.||
Worm 72 CAICLDNLQNNVDIPEDHVIKEELKIDPTTFGTTVIVMPCKHRFHYFCLTLWLEAQQTCPTCR 134
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.