DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10916 and TRAIP

DIOPT Version :10

Sequence 1:NP_611303.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_005870.2 Gene:TRAIP / 10293 HGNCID:30764 Length:469 Species:Homo sapiens


Alignment Length:100 Identity:36/100 - (36%)
Similarity:51/100 - (51%) Gaps:13/100 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNILCAICNEFF-RANDIIFSTSRCGHVFHKDCLTRWLNR--SRTCPQCRDPCDRRR-VHRLYLN 88
            :..||.||::|| .:.|:  :...|||.||..||.:|...  ||||||||....:|. :::|:.:
Human     3 IRALCTICSDFFDHSRDV--AAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFD 65

  Fly    89 FAEAPE-FDDTELPKVAMDWVPIDLD------RDS 116
            .|:..| ..|.|..|..:|.|...|.      |||
Human    66 LAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10916NP_611303.1 RING-H2_TRAIP 31..74 CDD:438143 21/45 (47%)
DUF3421 135..247 CDD:463390
TRAIPNP_005870.2 RING-H2_TRAIP 6..50 CDD:438143 21/45 (47%)
EnvC 65..>278 CDD:443969 10/35 (29%)
Interaction with CYLD. /evidence=ECO:0000269|PubMed:14676304 211..469
PIP-box. /evidence=ECO:0000269|PubMed:26711499 460..469
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.