DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgp-1 and eIF5B

DIOPT Version :9

Sequence 1:NP_611302.1 Gene:Dgp-1 / 37080 FlyBaseID:FBgn0027836 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001246599.1 Gene:eIF5B / 44261 FlyBaseID:FBgn0026259 Length:1144 Species:Drosophila melanogaster


Alignment Length:448 Identity:109/448 - (24%)
Similarity:180/448 - (40%) Gaps:115/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EDGSD--SGLNPEQFEASVATLHLLAAN--------IDADVVKLRERRAEKGQSAQFLIRKHIDT 138
            ||.||  .|.:.:..|.||      .||        .:|.::| |:..|||.:|           
  Fly   503 EDDSDDSDGDSDDSREVSV------LANDPESRRLRAEARILK-RQAEAEKKRS----------- 549

  Fly   139 TDFMEIR---VAVVGNVDAGKSTLLGVL--THGELDNGRGHARQRLFRHKHEIESGRTSSVGNDI 198
            ||  |:|   |.|:|:||.||:.:|..|  ||.: |:..|...|::                   
  Fly   550 TD--ELRAGVVCVLGHVDTGKTKILDKLRRTHVQ-DSEAGGITQQI------------------- 592

  Fly   199 LGFDGVGNVVNKPDHGHLDWVKIC---ENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMI 260
                |..||..:.......:||..   |:....:..||..|||.:......|.:  ..|..:|::
  Fly   593 ----GATNVPIEAIKEQTKYVKAAAGFEHRLPGLLIIDTPGHESFSNLRNRGSS--LCDIAILVV 651

  Fly   261 GANAGIIGMTKEHLGLALALAVPVFVVVTKIDMC----------PANVLQE---NMKLLFKMLKS 312
            ....|:...|.|.:.|......|..|.:.|||..          ..:||:|   |.:|.|:    
  Fly   652 DIMHGLEPQTIESIQLLKKKKCPFIVALNKIDRLYDWKQLARRDVRDVLKEQQSNTQLEFQ---- 712

  Fly   313 QGCRKVPVVVRSHDDVVLSATNFVSERLCP-----IFQVSNVTGDNL-ELLKMFL----NLLSTR 367
               ::...|:....:..|:|..|. |...|     :...|.::|:.: .||.|..    |:|:.|
  Fly   713 ---QRTKDVILQFAEQGLNAALFY-ENTDPKTYISLVPTSAISGEGMGNLLFMIADFCQNMLAKR 773

  Fly   368 MPGSESLPAEFQIDDVYAVPGVGTVVSGTCLQGTIRLNDCLMLGPDAVGSFVPIT--IKSIHRKR 430
            :..||.|.|  .:.:|.|:||:||.:....:.|.:|....:::    .|:..||.  |:|:...:
  Fly   774 LMYSEELQA--TVLEVKALPGLGTTIDAILINGKLREGQTMVV----AGTDGPIVTQIRSLLMPQ 832

  Fly   431 -MNVARVRCGQTASFALKKIKRAYLRKGMVMVSQDLKPQACWEFEG-EILVLHHPTTI 486
             |...||:   .|....|::|.|   :|:.:.::||:.    ...| .:|:.|.|..:
  Fly   833 PMKELRVK---NAYVEYKEVKAA---QGVKIAAKDLEK----AIAGINLLIAHKPDEV 880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dgp-1NP_611302.1 GTPBP1 38..555 CDD:227583 109/448 (24%)
GTPBP1_like 145..367 CDD:206728 57/252 (23%)
GTPBP_II 376..462 CDD:293895 22/88 (25%)
GTPBP_III 468..553 CDD:294007 4/20 (20%)
eIF5BNP_001246599.1 PRK04004 553..1129 CDD:235195 89/378 (24%)
IF2_eIF5B 557..769 CDD:206674 54/245 (22%)
aeIF5B_II 779..889 CDD:293904 29/118 (25%)
IF-2 890..993 CDD:288813
IF2_aeIF5B_IV 1016..1110 CDD:293911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.