DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgp-1 and CG33158

DIOPT Version :9

Sequence 1:NP_611302.1 Gene:Dgp-1 / 37080 FlyBaseID:FBgn0027836 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster


Alignment Length:410 Identity:72/410 - (17%)
Similarity:131/410 - (31%) Gaps:146/410 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 ADVVKLRERRAEKGQSAQFLIRKHIDTTDFMEIRVAVVGNVDAGKSTLLG--VLTHGELDNGRGH 174
            :|:|.|:.||.:        :|           .:.::.:||.||:||..  |.::|.:......
  Fly     7 SDLVLLQRRRQQ--------VR-----------NICILAHVDHGKTTLADSLVASNGIISQRMAG 52

  Fly   175 ARQRLFRHKHEIESGRTSSVGNDILGFDGVGNVVNKPDH--------GHLDW-------VKICEN 224
            ..:.|.....|.|.|.|....:..|.:.....:...||:        ||:|:       |::|:.
  Fly    53 KLRYLDNRSDEQERGITMKSSSISLYYQEAEEMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDG 117

  Fly   225 SAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIGANAGIIGMTKEHLGLALALAVPVFVVVT 289
            :..|:..::..|.:                       ..|.:..:.:|.|       .|| :|:.
  Fly   118 AIVVVDVVEGVGPQ-----------------------TRACLRQIYEEQL-------KPV-LVLN 151

  Fly   290 KIDMCPANVLQENMKLLFKMLKSQGCRKVPVVVRSHDDVVLSATNFVSERLCPIFQVSNVTGDNL 354
            |:|..   :|::.|.              |:....|...||...|.|   |..||....:..:::
  Fly   152 KLDRL---ILEKQMD--------------PLDAYFHLCQVLEQVNAV---LGSIFASDILAKEDI 196

  Fly   355 ELLKMFLNLLSTRMPGSESLPAEFQIDDVYAVPGVGTVVSGTCLQGTIRLNDCLMLGPDAVGSFV 419
                       |:....||...|....::|..|..|.|:..:...|          ...:|..|.
  Fly   197 -----------TKKDNYESALEEVDDSELYFSPSSGNVIFCSAYDG----------WAFSVRDFA 240

  Fly   420 PITIKSIHRKRMNVARVRCG----------------------QTASFALKKIKRAY----LRK-- 456
            .:..|.:...|.::..|..|                      ....|.|:.|...|    :||  
  Fly   241 AMYAKRLEMSRKDLENVLWGDFYYNSKKKEALPGAQEKAKKPMFVQFVLENIWSLYDIIAIRKDK 305

  Fly   457 ----------GMVMVSQDLK 466
                      |:.:.::||:
  Fly   306 DKLPGIAEKLGLKLATRDLR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dgp-1NP_611302.1 GTPBP1 38..555 CDD:227583 72/410 (18%)
GTPBP1_like 145..367 CDD:206728 42/238 (18%)
GTPBP_II 376..462 CDD:293895 19/123 (15%)
GTPBP_III 468..553 CDD:294007
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 69/402 (17%)
EF2 20..249 CDD:206672 55/311 (18%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.